PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G132500.1
Common NamePHAVU_005G132500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family TCP
Protein Properties Length: 170aa    MW: 18640.2 Da    PI: 9.2451
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G132500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP102.47.6e-3240108573
                 TCP   5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                         + ++ ++h kv+gRdRRvRlsa caar+F+L++eLG ++d++tieWLl +a+pai+++tgt+  ++  +
  Phvul.005G132500.1  40 RGSKGDRHIKVNGRDRRVRLSAICAARIFQLTRELGKKTDGETIEWLLHKAEPAIIAATGTGIVPSITT 108
                         66789********************************************************66666322 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036347.7E-2742110IPR005333Transcription factor, TCP
PROSITE profilePS5136924.7644397IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MINIMNSMGS VNNISVEREY ESFSAKEGPS MVKNKRPPSR GSKGDRHIKV NGRDRRVRLS  60
AICAARIFQL TRELGKKTDG ETIEWLLHKA EPAIIAATGT GIVPSITTSV DTAATFMATT  120
TTFLPLHTIA AQDANLVTVA AVARTEQPIP PFHFDFEWMQ HSDLGFRDN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-160AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150170.11e-124hypothetical protein PHAVU_005G132500g
TrEMBLV7BW511e-124V7BW51_PHAVU; Uncharacterized protein
STRINGGSMUA_Achr7P20990_0011e-32(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.11e-33TCP family protein